NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI2173J19968_10045438

Scaffold JGI2173J19968_10045438


Overview

Basic Information
Taxon OID3300001752 Open in IMG/M
Scaffold IDJGI2173J19968_10045438 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1417
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050784Metagenome145Y

Sequences

Protein IDFamilyRBSSequence
JGI2173J19968_100454382F050784AGGAGGMKEMWTESGFTKRNRGRMGIMGSVATFLGVAFAIVGIISEASLTLLGLIPTSWYLLAIASFIFSLGCWLGWAVGIYLHAKETEGKE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.