NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RCM27_1025964

Scaffold RCM27_1025964


Overview

Basic Information
Taxon OID3300001836 Open in IMG/M
Scaffold IDRCM27_1025964 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1344
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameAfu?, Para, Brazil
CoordinatesLat. (o)-0.083883Long. (o)-51.051417Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F011394Metagenome / Metatranscriptome291Y
F074876Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
RCM27_10259642F000671AGGMEKILCYSCNKSKNKLNVKKSTLLPINLLMCETCITSKIEPRWVVILAGRQSGPEYVRDFVLKKRYIGNDISASELLV*
RCM27_10259643F074876AGGVKESYEVINIVFIHTEGVYGTIEHLGAFASLVKYTKDGIEYEELLENDEFAIVDEIVFEHLEEEKGD*
RCM27_10259644F011394N/AMSDHFKYGINEWTGEPNKPVFYNKDMAMKIRQLSKPVSNLQMDIVKYPEFLALRLYEDNFKQYDGTAKEKVIEYVGLVKSIIESYGVRCELEGRPSERKL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.