Scaffold RCM33_1070703

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold RCM33_1070703

Scaffold RCM33_1070703

Overview

Basic Information
Taxon OID	3300001838 Open in IMG/M
Scaffold ID	RCM33_1070703 Open in IMG/M
Source Dataset Name	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	668
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location Name	Ponta de Pedras, Para, Brazil
Coordinates	Lat. (^o)	-1.519367	Long. (^o)	-48.91795	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018151	Metagenome	236	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM33_10707032	F018151	N/A	MKRFLIFLMLLFASQAKSQSYYNNGNTCDFILVQGDTALITAFNGLDKKDFGIYLGVKYSGLFSGSIFYTPFNAINRLGISKGYLNDGFRVSAGVKMTPIGTTNYSIVPEFGVQFHPIRFISKDRNSFDIVLTYYQSTSTRVGFGISFPIQYRNNFRL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.