NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RCM34_1127690

Scaffold RCM34_1127690


Overview

Basic Information
Taxon OID3300001843 Open in IMG/M
Scaffold IDRCM34_1127690 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)641
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NamePonta de Pedras, Para, Brazil
CoordinatesLat. (o)-1.519367Long. (o)-48.91795Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000671Metagenome / Metatranscriptome945Y
F013891Metagenome / Metatranscriptome267Y
F074876Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
RCM34_11276901F000671N/AMEKILCYSCNKTKNKLNVKKSSLLSINLLMCESCIEAKYEPRWVIIISGRQLGAEYVRDFVLKKRYIGNEISASELLI*
RCM34_11276902F074876GAGMVLDANWKVNQVEENYETVSIVFIHSEKVYGTVDHLGAYASLVRYTIDGIEYSELLENDEFAIVDEIAFHHIIDDNRKNQE*
RCM34_11276903F013891N/ANLKMDVVKYPDFLALRVYEDNFKQYDGSIKERVIEYITLVKNIIESYGVRCELEGKPSGRKL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.