NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RCM31_10115093

Scaffold RCM31_10115093


Overview

Basic Information
Taxon OID3300001851 Open in IMG/M
Scaffold IDRCM31_10115093 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)881
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameAfu?, Para, Brazil
CoordinatesLat. (o)-0.156917Long. (o)-50.62255Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051919Metagenome143N

Sequences

Protein IDFamilyRBSSequence
RCM31_101150932F051919N/AMSNENVIYNPYYGDNLCNLLANSIVEKIKSVDPKLYVNISVTNVNSFFMTCGETEYSEPLDITEIFNSVMEDVPEPLKLIVKVFDLISYNTKRTSGTLLYSEQFSKYKKTLSENFTKYSEILNLNKKECYTNIKCFNTNVYVETLSNNNDVKLPKDYIEWKPNTKVFTSSQIFGKDLYSEKYVYMLFRYIAHTLFESGLCSVVKLSVNTNNPVDQLYWENVNFEIDSEYFLTSKNWTKSLIL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.