Scaffold JGI24422J19971_10223582

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24422J19971_10223582

Scaffold JGI24422J19971_10223582

Overview

Basic Information
Taxon OID	3300001854 Open in IMG/M
Scaffold ID	JGI24422J19971_10223582 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	800
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location Name	White Oak River estuary, North Carolina, USA
Coordinates	Lat. (^o)	34.6478111	Long. (^o)	-77.1112083	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034090	Metagenome	175	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24422J19971_102235822	F034090	N/A	MRLQFRFSFPPIYGIYDTGDGVIYVFGEHEDKIEDVLSHEVLHWAVQKTAGKHASLDLDNVPSKFLRV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.