NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12627J18819_10030395

Scaffold JGI12627J18819_10030395


Overview

Basic Information
Taxon OID3300001867 Open in IMG/M
Scaffold IDJGI12627J18819_10030395 Open in IMG/M
Source Dataset NameTexas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2232
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameDavy Crockett National Forest, Groveton, Texas, USA
CoordinatesLat. (o)31.11Long. (o)-95.15Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013245Metagenome / Metatranscriptome273Y

Sequences

Protein IDFamilyRBSSequence
JGI12627J18819_100303952F013245GGAGGMSGKRLCLAVLTVATILSISAVAQDEKNEVGGLLGRTFISDQGIQNATYFDPIIHSGKGLTVQGEYARRFWVTPIYSVSAEGLLVYNWDVDLNAGQYGNSVVPSDMKKLFVTPAARVNLFPTTAVSPWISFGAGFGHISQNTQLIYGGTNPGKSTTSAVIEAGFGLDVKVWRRLSIRMDVRDFWAGQPDFPLAPTGKTRQHNFFVGGGAFWRF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.