Scaffold FAAS_10472720

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold FAAS_10472720

Scaffold FAAS_10472720

Overview

Basic Information
Taxon OID	3300001880 Open in IMG/M
Scaffold ID	FAAS_10472720 Open in IMG/M
Source Dataset Name	Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	505
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Hindgut → Unclassified → Termite Hindgut → Termite Hindgut Microbial Communities From The Max Planck Institute, Bremen, Germany, Analyzing Fibers In The Hindgut Lumen

Source Dataset Sampling Location
Location Name	Max Planck Institute, Bremen, Germany
Coordinates	Lat. (^o)	53.109695	Long. (^o)	8.847543	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075029	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
FAAS_104727201	F075029	AGG	MGSPVFGFSDLPIIGENRCLRKLVNKTEGNKFVTMKHSKGLRLHLTEN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.