Scaffold GOS2267_102452

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2267_102452

Scaffold GOS2267_102452

Overview

Basic Information
Taxon OID	3300001934 Open in IMG/M
Scaffold ID	GOS2267_102452 Open in IMG/M
Source Dataset Name	Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1586
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Chesapeake Bay, Maryland, USA
Coordinates	Lat. (^o)	38.133335	Long. (^o)	-76.38333	Alt. (m)		Depth (m)	2.07
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027486	Metagenome	194	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2267_1024521	F027486	N/A	MTKKDNPICRSFRQDFPQFVKRAEALGVNISVGKGRRNGRERVFWLNGYKQLTGYTTNSDGSPFTLEDATRNIDKVLTHIDEDRAAAANLSIPERFARVMAEFRQMVPQYRMIGVVRHPNGDNGYVFFMAYYNGAVEIEGTEVAKAKAEWRKDESDKDHMARFCDMLEADFAQRQQGAAA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.