NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2226_1028276

Scaffold GOS2226_1028276


Overview

Basic Information
Taxon OID3300001943 Open in IMG/M
Scaffold IDGOS2226_1028276 Open in IMG/M
Source Dataset NameMarine microbial communities from Cape May, New Jersey, USA - GS010
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1507
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameCape May, New Jersey, USA
CoordinatesLat. (o)38.94Long. (o)-74.685Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001319Metagenome / Metatranscriptome723Y
F013703Metagenome / Metatranscriptome269Y

Sequences

Protein IDFamilyRBSSequence
GOS2226_10282761F001319AGGAGGMKKLWSIILLCGIVFGQLPQPTMVGQDDLQVPTLSINNFVNQAEIVGLEDTRVFLGITNILTENVMDSRYELVENDSDFELTARVVYLGKPRTSTTILGLFRRETTTTEVRVVVELKNKKTGVVRTGNGTGTIDREISSTGFQINEE
GOS2226_10282762F013703N/AFPIQFRKNTINLQTFVSYTLFRYFEGLKTENKYLLLESPILIYPGASIDINFTETFKMNFGFNVGYNTLVNDLGERNISYSIIFGTNF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.