Scaffold GOS2244_1037219

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2244_1037219

Scaffold GOS2244_1037219

Overview

Basic Information
Taxon OID	3300001946 Open in IMG/M
Scaffold ID	GOS2244_1037219 Open in IMG/M
Source Dataset Name	Marine microbial communities from North James Bay, Santigo Island, Equador
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	967
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	North James Bay, Santigo Island, Equador
Coordinates	Lat. (^o)	-0.2	Long. (^o)	-90.83528	Alt. (m)		Depth (m)	2.1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009608	Metagenome / Metatranscriptome	315	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2244_10372192	F009608	N/A	MMKYIKPLNEGRPMFQDTPNEFAYLDFKKWAYKNRSKIKRELSKINDGTTLFIALRKLWMEWSNKEAKEWSYLHSTDVAKKDFGRALAVMLKSDDLIIKKQGNKLTDLK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.