Scaffold GOS2218_1026243

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2218_1026243

Scaffold GOS2218_1026243

Overview

Basic Information
Taxon OID	3300001947 Open in IMG/M
Scaffold ID	GOS2218_1026243 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Gulf of Maine, Canada - GS002
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1399
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Gulf of Maine, Canada
Coordinates	Lat. (^o)	42.503056	Long. (^o)	-67.24	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064391	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2218_10262432	F064391	N/A	MNKLTDQPPSTRNKGNTSKVKTKTHIYPRKNRWGIVWSDTPVSGSRRNLITEKLGKKIIEEFKLGFSSVQLEEKYRIDNDTILRFVKKILKKDEFESIEKQKINQHM*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.