NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2266_1018431

Scaffold GOS2266_1018431


Overview

Basic Information
Taxon OID3300001956 Open in IMG/M
Scaffold IDGOS2266_1018431 Open in IMG/M
Source Dataset NameMarine microbial communities from Rangirora Atoll, Polynesia Archipelagos - GS051
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1829
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameRangirora Atoll, Polynesia Archipelagos
CoordinatesLat. (o)-15.143611Long. (o)-147.435Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005315Metagenome405Y
F007006Metagenome / Metatranscriptome360Y

Sequences

Protein IDFamilyRBSSequence
GOS2266_10184313F005315N/ASEKTQAYPYLLQNHFDAELINLAQSGASEYLITTQIEEAVKLKHNLIVVGHTSEYRWQVWDARNDIIQGFLVANHVLKNEKYYRNWILSEQILSNRRSEDKKHQAAWHAAGMLYYSEEELVRRLWSGAVSKQILLCQRASIPMIHHCCFPHLQPYLSELTDDYVEFHLDLEKHKDFAPDKSHAGANSHIKLTKMLMNKHQPTL*
GOS2266_10184314F007006N/AMRNKMEVALQEEVRKEISRIVDLMIQAESIRESIAELKKDIKNEYGIPIATITKVATIVRKNSLQEEEEKWEEIKEWVDACS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.