 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300001963 Open in IMG/M |
| Scaffold ID | GOS2229_1008479 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Nags Head, North Carolina, USA - GS013 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1387 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Nags Head, North Carolina, USA | |||||||
| Coordinates | Lat. (o) | 35.6 | Long. (o) | -75.82 | Alt. (m) | Depth (m) | 2.1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028553 | Metagenome | 191 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GOS2229_10084792 | F028553 | GGA | MAERQGAFANLNVENRFDDFNLPVSGSMRFEKRPNQSRSELDLYKTFDGSMGSVTPSMGYTTEETKYRDGQADVKNRARTVRLGLDGATTLGPVDVSGNAMGSRTMQDNTYTFPFASFTQGSSSTFTKLGAAAKMGAFDFNVSRQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |