Scaffold GOS2243_1073344

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2243_1073344

Scaffold GOS2243_1073344

Overview

Basic Information
Taxon OID	3300001965 Open in IMG/M
Scaffold ID	GOS2243_1073344 Open in IMG/M
Source Dataset Name	Marine microbial communities from Coastal Floreana, Equador - GS028
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1475
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Coastal Floreana, Equador
Coordinates	Lat. (^o)	-1.2169445	Long. (^o)	-90.319725	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003028	Metagenome / Metatranscriptome	512	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2243_10733441	F003028	N/A	MKSAYITVIGSLPIRFDIEQARALGPVIASANSNKSITFDYATVNTETNLQDMLNSPNFRGAELLVPENLFKKYVFFDGVTCLPEFPGLKSYDIDPEKCSPQVLSLMLSVYLKQTIVFLLGYDISNPTELTRLKSIMIANPNTKFMYICDPPRTYQLDDLANGFCDNYIKFQELIDRAK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.