NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2236_1003903

Scaffold GOS2236_1003903


Overview

Basic Information
Taxon OID3300001968 Open in IMG/M
Scaffold IDGOS2236_1003903 Open in IMG/M
Source Dataset NameMarine microbial communities from Lake Gatun, Panama - GS020
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1528
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameLake Gatun, Panama
CoordinatesLat. (o)9.164444Long. (o)-79.83611Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018000Metagenome / Metatranscriptome237Y
F028174Metagenome / Metatranscriptome192Y

Sequences

Protein IDFamilyRBSSequence
GOS2236_10039031F018000N/AMAEVYKNSQSPIYHQVLWNGEVKTLDAVPSVKLFDVTLDPAVNPTISPTTVLTTLTGIQDENNPGTYYVNIPYQFTNRNRTLRLRWDYSIDSTLVQRYDDVFVVTPYADLNHIYDLGFSMDASDPNYKSYKELSLSEKYARKQIENYTGQKFHLYDDVQVVYGYGSDILPLSAKLYELHELYAADQLLLDNFNEINNWGYEVIISETGYGIRINKANMLDNTVYVANGMVPPTINDSSGV
GOS2236_10039032F028174N/AIREKVTNIRDVSGNVIWTEINFPSETPTVFEVIGTTPITDPFGNVLGYNSSMKRSENQQIGL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.