NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOS2248_10039849

Scaffold GOS2248_10039849


Overview

Basic Information
Taxon OID3300001970 Open in IMG/M
Scaffold IDGOS2248_10039849 Open in IMG/M
Source Dataset NameHypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2679
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (12.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NamePunta Cormorant, Floreana Island, Equador
CoordinatesLat. (o)-1.2283334Long. (o)-90.42917Alt. (m)Depth (m).2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F081278Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
GOS2248_100398497F081278N/AMTYTPIRRHATAADFTRWEALAETMSDAALWYAARDCRKVEAIWRRVDPVVEGFYSDQASTYSMVLARRRGR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.