Scaffold GOS2248_10099471

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2248_10099471

Scaffold GOS2248_10099471

Overview

Basic Information
Taxon OID	3300001970 Open in IMG/M
Scaffold ID	GOS2248_10099471 Open in IMG/M
Source Dataset Name	Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1756
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Punta Cormorant, Floreana Island, Equador
Coordinates	Lat. (^o)	-1.2283334	Long. (^o)	-90.42917	Alt. (m)		Depth (m)	.2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044811	Metagenome	154	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2248_100994712	F044811	GGTGG	MWRHWIGLPHKFRADPRNGHAADCLIMTWNVLEDAGVPHPPFDPIWLDLAESGKHRLLARAYERLTIPLDAPEEYAVTLFSTERTIGIGVVVDGGLLHVHHRRGVQWMPLDRCKPLEFRKFT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.