Scaffold GOS2216_10125148

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2216_10125148

Scaffold GOS2216_10125148

Overview

Basic Information
Taxon OID	3300001972 Open in IMG/M
Scaffold ID	GOS2216_10125148 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Sargasso Sea - GS000d
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1510
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Sargasso Sea
Coordinates	Lat. (^o)	31.175	Long. (^o)	-64.32433	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057000	Metagenome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2216_101251483	F057000	AGG	VIKKLNKHRVRRERPLTSFYYDKDTSDYWRINIQLWDIEFELRELREQIWIHVLRLRFAIANTKSFEIKTQLKFKEKIVLEHIANIEKLREENKDAWRKNLKNEYGENAIWFES*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.