Basic Information | |
---|---|
Taxon OID | 3300001975 Open in IMG/M |
Scaffold ID | Draft_11076953 Open in IMG/M |
Source Dataset Name | Biogas fermenter microbial communities from the University of Hamburg, Germany |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 523 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Hamburg, Germany | |||||||
Coordinates | Lat. (o) | 53.458783 | Long. (o) | 9.968812 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088943 | Metagenome / Metatranscriptome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Draft_110769531 | F088943 | N/A | SVANEDRLVAIYRRTGDTQFTHAQIADLVPCGTMLRYTVPGIFIPARDSKGVPLKGGSRARSNVWRWHPRAAELCRQAIERDRRWENLAEGLTGGRP* |
⦗Top⦘ |