NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold smpD1_1059517

Scaffold smpD1_1059517


Overview

Basic Information
Taxon OID3300002025 Open in IMG/M
Scaffold IDsmpD1_1059517 Open in IMG/M
Source Dataset NamePermafrost and active layer soil microbial communities from McGill Arctic Research Station (MARS), Canada, for enrichment studies - Sample_D1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1046
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost And Active Layer Soil → Permafrost And Active Layer Soil Microbial Communities From Mcgill Arctic Research Station (Mars), Canada, For Enrichment Studies

Source Dataset Sampling Location
Location NameAxel Heiberg Island, Nunavut, Canada
CoordinatesLat. (o)79.26Long. (o)-90.46Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003672Metagenome / Metatranscriptome474Y

Sequences

Protein IDFamilyRBSSequence
smpD1_10595174F003672N/AREGPPRAPKGFDRHGFVARLEEMMNRGRLLIDKRKDLASASKWEAQTQALLRDELGDHAYTRRFEVALSQRRPEGLLAAYGVLWATYEDALKGDLKPAVKERRPS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.