Scaffold MIS_10118381

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold MIS_10118381

Scaffold MIS_10118381

Overview

Basic Information
Taxon OID	3300002027 Open in IMG/M
Scaffold ID	MIS_10118381 Open in IMG/M
Source Dataset Name	Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1897
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Source Dataset Sampling Location
Location Name	Middle Island Sinkhole, Lake Huron Michigan, USA
Coordinates	Lat. (^o)	45.19843	Long. (^o)	-83.32721	Alt. (m)		Depth (m)	23
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079376	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
MIS_101183812	F079376	N/A	MSDIVIIREPGRPCVSFEVMRVCRTTEEGGRQIKHRESDSLVVPMKAGNAAGGKEATHESVV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.