NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MIS_10180141

Scaffold MIS_10180141


Overview

Basic Information
Taxon OID3300002027 Open in IMG/M
Scaffold IDMIS_10180141 Open in IMG/M
Source Dataset NameSinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1524
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Source Dataset Sampling Location
Location NameMiddle Island Sinkhole, Lake Huron Michigan, USA
CoordinatesLat. (o)45.19843Long. (o)-83.32721Alt. (m)Depth (m)23
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006349Metagenome / Metatranscriptome375Y

Sequences

Protein IDFamilyRBSSequence
MIS_101801412F006349N/AMLCVLKGDVHGFGSLMHAGADAPVRKALEEAVARWAPPGAIAETGAGDAALIADDDPVALAQTARHLMDDVYNVPGQPRLRIALHYGAVQTRQRSADLRSIVVGGDAILCVSRVEPVVAPGQIWATAEFREQFLQRPSLWRTVPIPGPAGNERFNVRKQGSEEPDLWVRLYRLES*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.