Scaffold BIB32012_10062974

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BIB32012_10062974

Scaffold BIB32012_10062974

Overview

Basic Information
Taxon OID	3300002036 Open in IMG/M
Scaffold ID	BIB32012_10062974 Open in IMG/M
Source Dataset Name	Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_B3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1320
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease

Source Dataset Sampling Location
Location Name	Bare Island, Sydney, Australia
Coordinates	Lat. (^o)	-33.59	Long. (^o)	151.13	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037503	Metagenome / Metatranscriptome	168	Y

Sequences

Protein ID	Family	RBS	Sequence
BIB32012_100629742	F037503	GAG	MEVELLIGLGGFTAYQPLTNSECHDTTSAVRLWVLRSIAERETTQTIS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.