NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GOScombined01_102155265

Scaffold GOScombined01_102155265


Overview

Basic Information
Taxon OID3300002040 Open in IMG/M
Scaffold IDGOScombined01_102155265 Open in IMG/M
Source Dataset NameGS000c - Sargasso Station 3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3571
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location NameMoorea, Outside Cooks Bay, Polynesia Archipelagos
CoordinatesLat. (o)-17.475834Long. (o)-149.81223Alt. (m)Depth (m)1.4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002334Metagenome569N
F045808Metagenome / Metatranscriptome152N

Sequences

Protein IDFamilyRBSSequence
GOScombined01_1021552651F045808N/AFDLVIRMRTDLEFHDRVPLEACKGNGLYMMNGSYQAGAGREYCDWFYCGPHKRVQEFDPLKVFDDFYADGIRHMHDLVIETLRSLQIPHSVLDLKAWMMDRSKIK*
GOScombined01_1021552653F002334GGAMTLGVFHQVYTRPKATEEAIKSFRQFHPDIPYVLICDGGKSFHRIAKRYDCLYVHEEDNLGYRDHTHASGIYGMTKEEVLEWLRRFRLACTLCNTDHILMMEDDILIRGEIHVPEEWEFAGQAKPGNLLQEPFMTYLTEKYGVEWNVNYYGTGGGSIFNAKTFLENYERVIKIFDEEFDYIKENLCGNLGWVDVWMPMYYFLSGKKYRHNNLLTETTSNPIWTISKEPIVHQYKVHYE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.