Scaffold SMTZ1_10005610

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SMTZ1_10005610

Scaffold SMTZ1_10005610

Overview

Basic Information
Taxon OID	3300002052 Open in IMG/M
Scaffold ID	SMTZ1_10005610 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12629
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (63.64%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location Name	White Oak River estuary, North Carolina, USA
Coordinates	Lat. (^o)	34.640199	Long. (^o)	-77.109447	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055829	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
SMTZ1_1000561011	F055829	N/A	KHVKENGITSIILFDYILDLSDFEDTKGLWEQVQEAIDLVEKETGKRLHLDIVFTSQGNLLGKHPSIAESALRVTKHELETSTIPDTAKVGLILGEHGYPPGNGEEDVIGINMEEVRKNIRHLYDKELSRLRPGITEYRLGMNEFNNHPESPQTSSMECMIDFLHRGFDTIIFQPYYFTNETIDLFEHLRHWAFEVKGIDEHELHGGHEILHNYRSDFDFRGARIIITGSLLGKYEKDPDAPLLKKAYNLFTGGIAQTIVKKLKSLHN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.