NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24028J26656_1016354

Scaffold JGI24028J26656_1016354


Overview

Basic Information
Taxon OID3300002091 Open in IMG/M
Scaffold IDJGI24028J26656_1016354 Open in IMG/M
Source Dataset NameLentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-F8 metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)788
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location NameBrandenburg, Germany
CoordinatesLat. (o)53.1666Long. (o)13.0333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000934Metagenome / Metatranscriptome828Y
F068572Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
JGI24028J26656_10163541F000934AGTAGMPNLTTILSISESVMINDQRFVGQIISRNKRISTSEVMTVVPFQFTFKPMNYLLYSKNRDLLANLRYYDRSLTQYLNFGSTGWVNYISYQGDMTPSQIPSCQWQTSSTGTNLVLGNLPSISSTAYIVKAGDFCQMDSYCYIATQNVLRGSGSTVTIPVHRTILTALVSPQNAVIGQYGTTIAMGGNTYTGCTFPVILQAYPTYTLIPMTNDSFIQWSNGFQAI
JGI24028J26656_10163542F068572N/AIANMSAIDTQSAMAFIAKNQNSIWAANQAAQRSLPQSR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.