NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24219J26650_1010585

Scaffold JGI24219J26650_1010585


Overview

Basic Information
Taxon OID3300002098 Open in IMG/M
Scaffold IDJGI24219J26650_1010585 Open in IMG/M
Source Dataset NameLentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-B2 co-culture F-B7 metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1526
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location NameBrandenburg, Germany
CoordinatesLat. (o)53.152741Long. (o)13.022518Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000324Metagenome / Metatranscriptome1299Y
F026565Metagenome / Metatranscriptome197Y

Sequences

Protein IDFamilyRBSSequence
JGI24219J26650_10105852F026565GGAMAIFNQNTLTQVSGFDNPIIAGELVWEQQTYWNLAIKASDGVTPIDLTGATINAQIIRREVSNIQDTRSGLSFDISNYEPTPTPVTLTVTNISASTGQFTLVIDDSAWSLIDTDPELDINAQDCVGFSGRIKISFASIGSTPANDYIIFLLFLVRSDGIVVE*
JGI24219J26650_10105853F000324N/AMNSTPLNPAHSVTYDGATVNVYHANKNEGLPKHEHTFAHLTMCHAGSVIVRKEGRELVMTKDTQPVNLVANEWHELEALEDGTVFVNVFAEGKY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.