NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24809J26612_1003164

Scaffold JGI24809J26612_1003164


Overview

Basic Information
Taxon OID3300002100 Open in IMG/M
Scaffold IDJGI24809J26612_1003164 Open in IMG/M
Source Dataset NameSoil microbial communities from Manhattan, Kansas, USA - Sample 500um MDA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5072
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella → Candidatus Entotheonella palauensis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Kansas (Konza Prairie Natural Area And Manhattan, Kansas, Usa)

Source Dataset Sampling Location
Location NameManhattan, Kansas, USA
CoordinatesLat. (o)39.214Long. (o)-96.5852Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000621Metagenome981Y
F027650Metagenome194Y

Sequences

Protein IDFamilyRBSSequence
JGI24809J26612_10031646F000621GAGGMPRTKHELLDWLMDVPEDAEIGTDGAGLALLAILGTNVHLLEIGHIPNADELYAEAINQAMMERLRRIDAVGGETDTGVIIVTFHGYISGVPSLFSSDFNTAFVFKNKEQAEAFITEFANELHNPQILDCP*
JGI24809J26612_10031648F027650GAGGMEKLTVDAEGKIVIPPEVIQKRGLHPGDELTLVESAEGLLVYQGGVDEKTLAWWNRLGDRQRLLAEDYALRDENLSEHERDASWNQEAESIEIEAESDELDLPTN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.