NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CSTRM48_1006116

Scaffold CSTRM48_1006116


Overview

Basic Information
Taxon OID3300002130 Open in IMG/M
Scaffold IDCSTRM48_1006116 Open in IMG/M
Source Dataset NameWastewater microbial communities from Belvaux, Luxembourg - M48
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3176
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location
Location NameBelvaux, Luxembourg
CoordinatesLat. (o)49.506095Long. (o)5.943536Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025288Metagenome / Metatranscriptome202N
F031475Metagenome / Metatranscriptome182N

Sequences

Protein IDFamilyRBSSequence
CSTRM48_10061161F031475GGAMDANTADGSRDPLCANPQQQREKLTQLDFLTLEMMGISIEELRELLDEEELQAYFAFLRRQSSDLD
CSTRM48_10061162F025288AGGAMKNKWIWITVSVILLLGLIAGAGALGYQMGLRNANALALRGDDNPSSPRQQIPGMRDGMIIRRPAAFIGYFFLFPLRLLLGLAALLLVVWLVVKVAKAAWNGGDHKPKPAEAAVSPAATETVITEAPVSSSEPTSTPESDQK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.