Scaffold M2t6FKB2_1621032

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M2t6FKB2_1621032

Scaffold M2t6FKB2_1621032

Overview

Basic Information
Taxon OID	3300002134 Open in IMG/M
Scaffold ID	M2t6FKB2_1621032 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t6FKB2 (101f)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1236
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium MED-G22	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Baltic Sea, Analyzing Arctic Terrigenous Carbon Compounds

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	57.305	Long. (^o)	20.0745	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054828	Metagenome / Metatranscriptome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
M2t6FKB2_16210323	F054828	N/A	MSKEVKEAKKKIEMLVNHLIDSIDVDLLSDSQKIGYLKAVQQFVMPKMESIKQQTSFEVSEGLEWLIESDEKDIERDIHRKLGIGTYTGDKGLA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.