NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24766J26685_10007604

Scaffold JGI24766J26685_10007604


Overview

Basic Information
Taxon OID3300002161 Open in IMG/M
Scaffold IDJGI24766J26685_10007604 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2990
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000450Metagenome / Metatranscriptome1126Y
F000980Metagenome / Metatranscriptome814Y
F007470Metagenome / Metatranscriptome350Y

Sequences

Protein IDFamilyRBSSequence
JGI24766J26685_100076042F000450GGCGGMGDRANFGFVQPNGNTIVLYGHWAGNNMLGRLADAVIAARPRWTDSSYATRIAISQLVADQWNMETGWGLHVNEIGDNEHKIAIIDWDQQMFSLHEQADYRDESNKIRGMKNEAIFTMDLSSFCEKYALENILVN*
JGI24766J26685_100076044F007470GGAGMDYQSGFEDGVKFAREVIIANIRLWAEDNDEGQVLDDVADRIEFGTVDYDI*
JGI24766J26685_100076045F000311GAGMYFELTAPNRLSMERAYWDAEINGLDPMEMSSLTFNIGTGSIEKVSRLRDKYNLTESYISDYEPTGYTGR*
JGI24766J26685_100076046F000980AGGMTTYNKYTWVCTGDCDALIEYTFKDGFGWPNGVMQLTCPCNSKCTLLSVEDATIPYTDTPLTKEEPMETTEHLVPDTYNSNLLVTYKKINGYSNPEYITDKVTSIEWDLHNARQSQKTVSTLQSKIDAVKEIICEAYADSQDQDTLREIAEALGIELIKEVQFTASIEVTGTYSYDVLSDYSEYDLESVVTDSLYAESNDGNITIDDTEVCNVREA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.