NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24766J26685_10021679

Scaffold JGI24766J26685_10021679


Overview

Basic Information
Taxon OID3300002161 Open in IMG/M
Scaffold IDJGI24766J26685_10021679 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1606
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameSandusky Bay, Ohio, USA
CoordinatesLat. (o)41.474889Long. (o)-82.854137Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014089Metagenome / Metatranscriptome266Y
F025683Metagenome / Metatranscriptome200Y
F033645Metagenome / Metatranscriptome177Y

Sequences

Protein IDFamilyRBSSequence
JGI24766J26685_100216791F014089GGAMSDYVEIIYPQSMTAKLMHNGEVIAEYKVAQCDGCALVVKIDAFGYKIGQGGEKLAWLCGGCR*
JGI24766J26685_100216792F033645AGGGGGMAGFLDNYEDVAARIKRLWETHPSARVQNNIIEFNAEKGFILVQTEIFKEYEDEKPSAVDYAFGNVATYNVQMKKFFVEDTVTSSIGRCIGLLLGTDKRPTRQDMEKVETISTTVAKSTADDYDPWSKKFGDVPSFKTAAEAEQSGIPSLGSSMDEVAKQLGGQLVAEAPQCSHGHMIWKQAHEGAPKNWGGYFCTERTKATQCTPRWYVFASDGKWKPQV*
JGI24766J26685_100216793F025683GGAGMVLDLLDPQMLGRLSLVVILMVISAAAGYAKGFKEGKREGMARRKSMIRHAVNKGVN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.