Scaffold JGI24766J26685_10051299

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24766J26685_10051299

Scaffold JGI24766J26685_10051299

Overview

Basic Information
Taxon OID	3300002161 Open in IMG/M
Scaffold ID	JGI24766J26685_10051299 Open in IMG/M
Source Dataset Name	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	926
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location Name	Sandusky Bay, Ohio, USA
Coordinates	Lat. (^o)	41.474889	Long. (^o)	-82.854137	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003661	Metagenome / Metatranscriptome	474	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24766J26685_100512992	F003661	N/A	MDPTTVAVVAIIVAAGSEIIALLPIRSNGWIQLIMKALRTAFPKR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.