Scaffold JGI24713J26584_10073364

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24713J26584_10073364

Scaffold JGI24713J26584_10073364

Overview

Basic Information
Taxon OID	3300002166 Open in IMG/M
Scaffold ID	JGI24713J26584_10073364 Open in IMG/M
Source Dataset Name	Biogas fermentation microbial communities from Germany - Plant 4 DNA1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	730
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location Name	Bielefeld, North Rhine-Westphalia, Germany
Coordinates	Lat. (^o)	52.0385	Long. (^o)	8.4956	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033769	Metagenome / Metatranscriptome	176	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24713J26584_100733643	F033769	AGGAGG	MSTVNSGIKTATYTPSTVGVAVGRKYLRLTNESLDMRCRAGASNISSEAGIIIEPGQTVEFRPLPSENREIYVMSEGKAVKLAYYEVIA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.