 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300002176 Open in IMG/M |
| Scaffold ID | JGI24820J26691_1028556 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1221 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 0.0 | Long. (o) | -158.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103386 | Metagenome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24820J26691_10285562 | F103386 | AGGA | MQEMLQNYLKKSDSFVGGTLTGFFGMLTIGIIPNFVENYNLMITLEVFIFSIWFGILFYRHQLFKNNE* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |