NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24770J26754_10106270

Scaffold JGI24770J26754_10106270


Overview

Basic Information
Taxon OID3300002184 Open in IMG/M
Scaffold IDJGI24770J26754_10106270 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from Lake Erie, Canada
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1038
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameLake Erie, Canada
CoordinatesLat. (o)42.285437Long. (o)-81.355591Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064866Metagenome / Metatranscriptome128Y

Sequences

Protein IDFamilyRBSSequence
JGI24770J26754_101062702F064866N/AMKTSYLNFILFVYVMALPILSPAQMSDSQSLAKYSYPIFAVTGDQQYTGTAFFYRSGDTTYLVSNYHAIKGMSPLKKSITFNIDTLYLKYPVKNSNEFKVIGIDISEQITGKTEIFSMVNRIDLLKIPVETPADADIFFINDLIDEDYLNKEPEEVFVFGYPTDPGSIPAFYSQQQRLEGKVNPNGFTDYDASLRLNFPATSDDARAILGGTSRYYYFIRPYASQGYSGAPVFGKFRNADNQVIYRFTGVIFAGQPTTRQTWAIKGTVALKYLQGEL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.