NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24539J26755_10201856

Scaffold JGI24539J26755_10201856


Overview

Basic Information
Taxon OID3300002186 Open in IMG/M
Scaffold IDJGI24539J26755_10201856 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)574
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameNorwegian Sea, Atlantic Ocean
CoordinatesLat. (o)71.2008Long. (o)8.8666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007551Metagenome / Metatranscriptome349Y
F016880Metagenome / Metatranscriptome244Y

Sequences

Protein IDFamilyRBSSequence
JGI24539J26755_102018561F007551N/AEEGLITAILTQSVEDARYTGFNKIDLKHKIESINWIMGNDPQFLTYCKLLNIEPSYIQNKVKTYNDTRITSQQKMLLKPIVESLLKQDNYKEKYDTARI*
JGI24539J26755_102018562F016880AGGAGMTPQEYNKLREQEIIGQEMADETVKSIQLRKDIMKLALAESATNCTIMCGTLFAKFDVSIHKQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.