NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold KVRMV2_100038431

Scaffold KVRMV2_100038431


Overview

Basic Information
Taxon OID3300002231 Open in IMG/M
Scaffold IDKVRMV2_100038431 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Santorini caldera mats, Greece - red mat
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14350
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc

Source Dataset Sampling Location
Location NameSantorini caldera, Greece
CoordinatesLat. (o)36.5Long. (o)25.45Alt. (m)Depth (m)336
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000479Metagenome / Metatranscriptome1092Y
F010276Metagenome306Y

Sequences

Protein IDFamilyRBSSequence
KVRMV2_1000384317F000479AGGAMSKSVNILEVLEKAHLSKARMSKKAKLQIIDSYGRALMMKKVIDDFVKVNRNLIIDMGIGENANLLHGKDYQLHVSQKLSAKIDTKLIKEKLGELXYHKCKVPTQYQQIQAMPLEKNRVETDKTKYSIKEVADFDLAV*
KVRMV2_1000384318F010276AGGAGMPDNDNDLSNRLAVVEQTFGLRTRDNTNVAVPNEQPIQPQHTDNINWKALYKVLEAEVETVILDPNCPSYVKEWGQRVMDRXKQHLPR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.