Scaffold KVRMV2_101893595

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold KVRMV2_101893595

Scaffold KVRMV2_101893595

Overview

Basic Information
Taxon OID	3300002231 Open in IMG/M
Scaffold ID	KVRMV2_101893595 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Santorini caldera mats, Greece - red mat
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	545
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc

Source Dataset Sampling Location
Location Name	Santorini caldera, Greece
Coordinates	Lat. (^o)	36.5	Long. (^o)	25.45	Alt. (m)		Depth (m)	336
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042571	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
KVRMV2_1018935951	F042571	GAG	MALIDSKQLSKDLSGSFGINTGSFFVSGSDNRTQGSYVLSTSGSINTTGDGRVYEKGTSVVDTATALSIVFGG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.