Scaffold KVWGV2_10657171

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold KVWGV2_10657171

Scaffold KVWGV2_10657171

Overview

Basic Information
Taxon OID	3300002242 Open in IMG/M
Scaffold ID	KVWGV2_10657171 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey mat
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	979
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Hellenic Volcanic Arc

Source Dataset Sampling Location
Location Name	Kolumbo Volcano, Greece
Coordinates	Lat. (^o)	36.5	Long. (^o)	25.45	Alt. (m)		Depth (m)	494
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028310	Metagenome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
KVWGV2_106571712	F028310	GGAG	MGRKSLDEIYEEVDRESELECYDRQDLKLKDQDPYAIVGRSQTSGDILLKVGDELGYDVTKSLTFPEAMKLIKDLTNAVIDKY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.