NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J29593_1004708

Scaffold B570J29593_1004708


Overview

Basic Information
Taxon OID3300002295 Open in IMG/M
Scaffold IDB570J29593_1004708 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 28JUN2011 deep hole epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1059
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028720Metagenome / Metatranscriptome190N
F065451Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
B570J29593_10047081F028720AGAAGGMDAFWCLNKALLDLYKVMDNRGGPKEVNRYSGYCLHFVVLLDTIVLNYGDFDLNYAMDDPNAFDPLCKSTLLSVASSLSGIARTFWVEKRIHNRGDPVRDEWESLEYNFSGETCHMLKLALTRVLRYIKSNTDLSLCEMAEQHVEIFYGREP
B570J29593_10047082F065451N/AKLAPWKDDHALFLLSELSHAVLATLNPTPYDKDEVIENLLAGIVLVAYQKRGDFVLKLEFDRFEPRNELQRFWAPYINSEDPPRPAVQITQELLWLQARHVKNTEEFGTPYVCDHGYDKILHRVLKDCLKLLSSLTDLSIRTIAFRQMEKDV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.