NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24890J29729_1000054

Scaffold JGI24890J29729_1000054


Overview

Basic Information
Taxon OID3300002307 Open in IMG/M
Scaffold IDJGI24890J29729_1000054 Open in IMG/M
Source Dataset NameLentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)104437
Total Scaffold Genes172 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)148 (86.05%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales(Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location NameBrandenburg, Germany
CoordinatesLat. (o)53.1666Long. (o)13.0333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012969Metagenome / Metatranscriptome275Y
F025983Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
JGI24890J29729_1000054138F012969GAGGMKGGDISNEVPMRVLVSLDCLLVREHKVNKVLGISIPYIETAYSRVALAHFWRFRDTHGYRLELVGFELSQSDMDRILDDLDNLGTNPFNNATAYNVVADLVAELPYRPEVKYVIDIPDRGLRYGHWFLEEGATYGGEQRR*
JGI24890J29729_10000544F025983GGAMATNESGSLNGSLNEGATDGKYRKVRPNTTVAKGSGDDLTLANRRALHAYWNYDYIDQEAPNMQSPGVGSTKTNGRMSVTDAAIVNDQMGASN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.