NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24890J29729_1001392

Scaffold JGI24890J29729_1001392


Overview

Basic Information
Taxon OID3300002307 Open in IMG/M
Scaffold IDJGI24890J29729_1001392 Open in IMG/M
Source Dataset NameLentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11050
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (87.10%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location NameBrandenburg, Germany
CoordinatesLat. (o)53.1666Long. (o)13.0333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001507Metagenome / Metatranscriptome681Y
F095359Metagenome / Metatranscriptome105Y
F099311Metagenome103Y

Sequences

Protein IDFamilyRBSSequence
JGI24890J29729_100139220F099311AGGAGMATKTKAKTIPYLETWDTRYGKSQRIVLRKNGKFVDNTSLTALKAGKRVTR*
JGI24890J29729_100139223F001507GGAGGMTSTDFKLHTIKELVEQIYEDNFSHLDFMENMNGGDCDCSIHLTMNTIMTYWE*
JGI24890J29729_10013923F095359GGTGGMTIHIGGLGKEISFYCPVCSEKMIHTCIATLGTGRTIRYAFQCRDCELEIKSDRLGNAKLLKEMENA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.