Scaffold JGI24890J29729_1025168

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24890J29729_1025168

Scaffold JGI24890J29729_1025168

Overview

Basic Information
Taxon OID	3300002307 Open in IMG/M
Scaffold ID	JGI24890J29729_1025168 Open in IMG/M
Source Dataset Name	Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1350
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic → Lentic Enriched Actinobacterial Communities From Dystrophic Bog Grosse Fuchskuhle, Brandenburg, Germany

Source Dataset Sampling Location
Location Name	Brandenburg, Germany
Coordinates	Lat. (^o)	53.1666	Long. (^o)	13.0333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071912	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24890J29729_10251681	F071912	AGAAG	MQAEIALNVQQSIRPGECIDTYYAGKENSLKQCHATVEDNRFFQGLQSLGSGSSSTVTFNPNEGLAEVIVTLTLPAPATGVSLATAPGWGYSLIRRIGYRYGSSQLYYINSAQNLVQTLSLCEDSGKKQQMLFLGGQA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.