NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J29583_1000478

Scaffold B570J29583_1000478


Overview

Basic Information
Taxon OID3300002350 Open in IMG/M
Scaffold IDB570J29583_1000478 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 13JUL2012 deep hole epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3245
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000441Metagenome / Metatranscriptome1136Y
F002387Metagenome / Metatranscriptome565Y
F003603Metagenome / Metatranscriptome477Y
F007468Metagenome / Metatranscriptome350Y

Sequences

Protein IDFamilyRBSSequence
B570J29583_100047811F003603AGGCGGMKTKEQQVAELLCNYSEDHFFNPASLGGFLADQPTYTLDRIMEVVTWVIEKQARRYEREVENGGMVSEGLALAYKLDQVVDKIKEKNTFNNLKLPITXQERKAIIDRMPKEKTGDYKYSWLHETNNTNKQYIDQSYM*
B570J29583_10004782F002387GAGGMSDPHGIIGYYRKGGGIMASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDEFIYDEFNKFYNLKEGDEDYLC*
B570J29583_10004784F007468GGAGGLTTQTKSSKFIEYMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERYNNDNI*
B570J29583_10004787F000441AGGAGGMQQTDKYINEQLSKAQALLWSGSLHEQDEAHNIIAKLINDRMGKXEGQND*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.