NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24505J29691_1032062

Scaffold JGI24505J29691_1032062


Overview

Basic Information
Taxon OID3300002376 Open in IMG/M
Scaffold IDJGI24505J29691_1032062 Open in IMG/M
Source Dataset NameBiogas fermentation microbial communities from Germany - Plant 4 RNA2 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1116
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location NameBielefeld, North Rhine-Westphalia, Germany
CoordinatesLat. (o)52.0385Long. (o)8.4956Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F099151Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
JGI24505J29691_10320622F099151AGGMIMKFREETYKENGRIIKKYFIDDKEVTQDVFFKLTDELYENTKFKQDEHPDEICNCDDCQCLLDLVREIKIASDSEALDILKNEIDFRVQEAYLEGQYVLANELGNSLLKHAVKLEDELENLYENGSLDEYNEDS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.