Basic Information | |
---|---|
Taxon OID | 3300002405 Open in IMG/M |
Scaffold ID | G312J29652_10058643 Open in IMG/M |
Source Dataset Name | Earthworm egg capsule microbial community from the University of Washington, USA - E. fetida Yelm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 608 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Annelida → Reproductive System → Egg Capsule → Unclassified → Earthworm Egg Capsule → Earthworm Egg Capsule Microbial Community From The University Of Washington, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | University of Washington, USA | |||||||
Coordinates | Lat. (o) | 47.0 | Long. (o) | -122.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077889 | Metagenome | 117 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
G312J29652_100586433 | F077889 | N/A | MSNSVNLYEFIGFITFNIEVHELVDVYSFLVDCILVSNVPRATVHRH* |
⦗Top⦘ |