NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24768J34885_10222156

Scaffold JGI24768J34885_10222156


Overview

Basic Information
Taxon OID3300002447 Open in IMG/M
Scaffold IDJGI24768J34885_10222156 Open in IMG/M
Source Dataset NameFreshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)636
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment → Freshwater And Sediment Microbial Communities From A Dead Zone In Lake Erie, Usa

Source Dataset Sampling Location
Location NameCanada: Lake Ontario
CoordinatesLat. (o)43.933506Long. (o)-78.003845Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019601Metagenome228Y

Sequences

Protein IDFamilyRBSSequence
JGI24768J34885_102221561F019601N/AMNYLTAKNSSVIKGVNQHIEPTLIYSKQKAVHLNVHTWEGLPTWIAHEAKKAIFRSITNAIATNILQWTTPVLVATQLKMNLGHMHDVQTVFFRAMPRYQGIVAHDCLKVWLEEENIQGATSKSVYFGKCMVFLQDSEGKQFVVIQWFNRHEANGFDKISNVPSFKLAPETHTKSYSTLPITAIINGALMVP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.