Scaffold JGIcombinedJ30088_10045155

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGIcombinedJ30088_10045155

Scaffold JGIcombinedJ30088_10045155

Overview

Basic Information
Taxon OID	3300002448 Open in IMG/M
Scaffold ID	JGIcombinedJ30088_10045155 Open in IMG/M
Source Dataset Name	Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by freeze-thaw cycling (Combined Assembly Aplysina symbiont samples, ASSEMBLY_DATE=20140224)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2344
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated → Host-Associated Microbial Community Of The Marine Sponge Aplysina Aerophoba From Gulf Of Piran, Adriatic Sea

Source Dataset Sampling Location
Location Name	Gulf of Piran, Adriatic Sea
Coordinates	Lat. (^o)	45.5099	Long. (^o)	13.56	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010932	Metagenome / Metatranscriptome	297	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ30088_100451553	F010932	N/A	PLAEPGGQRRIEAARHYDYNWYNFIENGADPAHFSTLHLSDPDDGTWRSWFFNARDVPPFDAVETDYGMKVVSRKPAAEKGLSYVDEKSYALPSVMQIGDTEFTHFKEPREALARGSSNAHWMFVTPDDDDHFTLYTVDHYTGPDPDFMTRLAPSRRPVATAEKPEHDHRPLSPYRGSVRLEDIMTQSTQGNVACRQERLAASDKGIILQRRLILNAVDRVRQGLRPQGVPSPEEGARLVRMDSFTGIRAYPPKPDGETDVRSD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.